Cagrilintide Research: Amylin Biology, Human Trials, and FDA Status

The short version

Cagrilintide is a 37-amino-acid, lipidated amylin analogue engineered for greater physical stability and longer exposure than native human amylin. It is also known by development identifiers including AM833. Its biology centers on the calcitonin-receptor family, including amylin receptors formed when the calcitonin receptor associates with receptor-activity-modifying proteins.

The evidence base now spans receptor assays, structural studies, animal experiments, early human research, a randomized phase 2 monotherapy trial, and phase 3 trials of cagrilintide coadministered with semaglutide. These layers answer different questions. A result from the CagriSema combination cannot be assigned automatically to cagrilintide alone.

As of October 22, 2026, cagrilintide is not an FDA-approved drug and CagriSema remains investigational in the United States. FDA also states that cagrilintide is not a component of an approved drug and cannot be used in compounding under federal law. A vial marketed for research does not inherit the identity, manufacturing controls, stability, or clinical evidence of a sponsor's investigational material.

Exact identity: cagrilintide is not native amylin

FDA's Global Substance Registration System identifies cagrilintide as a complete 37-residue amylin analogue with the backbone sequence KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP. The record describes a disulfide bond between the second and seventh residues, a C-terminal proline amide, and a defined modification of the N-terminal lysine with a C20 fatty-diacid moiety through a gamma-glutamyl linker.

Each feature is part of the represented molecule. The disulfide constrains the N-terminal region, the C-terminal amide contributes to receptor activity, proline substitutions reduce the fibrillation tendency associated with human amylin, and lipidation promotes albumin binding and longer exposure.

A name alone is therefore incomplete identity evidence. A supplier record should specify the entire backbone, disulfide connectivity, terminal form, lipid chain, linker, and attachment site. Cagrilintide hydrochloride is also recorded as a salt form; the stated form and composition should remain consistent across the label, specification, and analytical report.

Receptor biology: the amylin system is a receptor family

Amylin pharmacology is more complicated than one peptide binding one receptor. Functional amylin receptors are formed by the calcitonin receptor together with one of several receptor-activity-modifying proteins, producing AMY1, AMY2, and AMY3 receptor subtypes. The calcitonin receptor itself can also respond to some ligands in this family.

The cagrilintide development program used receptor-binding and functional signaling assays to select a long-acting analogue while preserving activity. A 2025 structural study later resolved cagrilintide bound to active AMY1, AMY2, AMY3, and calcitonin receptors and reported an amylin-like binding mode with receptor-specific conformational dynamics.

These experiments establish molecular interactions under defined systems. They do not prove that every clinical outcome is caused by one receptor subtype, that signaling is identical across tissues, or that an online sample has the same structure and activity as the characterized material.

• Cell result: binding or signaling in a specified receptor system
• Structural result: a molecular model of a characterized ligand-receptor complex
• Animal result: a physiological or behavioral endpoint in a defined species and model
• Human result: an outcome in a specified trial population
• Supplier result: analytical evidence about one sample or lot

Why cagrilintide was engineered

Native human amylin has a strong tendency to form amyloid fibrils, creating a difficult peptide-design problem. The medicinal-chemistry program began from a pramlintide-like backbone containing proline substitutions that reduce fibrillation, then screened potential lipidation positions and fatty-acid modifications.

The selected analogue balanced receptor potency, solubility, physical stability, albumin binding, and sustained exposure. Published experiments included receptor assays, biophysical characterization, pharmacokinetic work, and animal studies used to compare candidates.

This design history matters for due diligence. Cagrilintide is not simply human amylin with a marketing name. Sequence substitutions, the disulfide, terminal amidation, and site-specific lipidation all influence what molecule was studied and what analytical evidence is needed to support identity.

Animal evidence: activity before clinical development

The discovery program evaluated cagrilintide and related analogues in animal models to examine exposure, food intake, and body-weight effects. The published work reports sustained pharmacology consistent with the selection of a long-acting candidate.

Animal research can connect receptor pharmacology to whole-organism responses and expose stability or tolerability problems before larger human studies. It cannot establish clinical effectiveness or long-term human safety. Species differences in receptor distribution, metabolism, feeding behavior, model design, and exposure can all change the observed result.

The defensible conclusion is that a specifically characterized analogue produced measurable biological effects in the reported models and justified human testing. Those studies do not validate broad claims about appetite, metabolic health, or any commercial research material.

Phase 1b combination research: an early signal with a small sample

A randomized phase 1b trial studied multiple cagrilintide groups coadministered with semaglutide in 96 adults with overweight or obesity. The main questions concerned safety, tolerability, pharmacokinetics, and early pharmacodynamic signals rather than definitive clinical efficacy.

The study reported body-weight reductions over 20 weeks and found that gastrointestinal adverse events were the most frequent events. Because all active cagrilintide groups were studied with semaglutide, the outcome cannot be treated as a cagrilintide-monotherapy result.

Small early-phase studies are useful for selecting later research questions. They do not provide the precision, duration, population breadth, or comparator structure needed for a settled estimate of benefit or risk.

Phase 2 monotherapy evidence

The clearest published monotherapy evidence comes from a 26-week randomized, double-blind phase 2 trial conducted at 57 sites in ten countries. The study assigned 706 participants across cagrilintide groups, 99 to liraglutide, and 101 to placebo. Participants had overweight or obesity and did not have diabetes.

Mean percentage body-weight reductions were greater across the cagrilintide groups than with placebo. In the highest studied cagrilintide group, the trial-product estimand was 10.8%, compared with 3.0% for placebo and 9.0% for liraglutide. The result supports a dose-response signal under the trial's specific design; it does not predict an individual's outcome or establish superiority to every approved weight-management product.

Gastrointestinal disorders and administration-site reactions were the most frequent adverse events. Gastrointestinal events occurred more often with cagrilintide than placebo. Interpretation should therefore include both the efficacy signal and the tolerability findings.

REDEFINE 1: phase 3 combination and component evidence

REDEFINE 1 was a 68-week, randomized, double-blind phase 3a trial in 3,417 adults with overweight or obesity and no diabetes. It included CagriSema, semaglutide alone, cagrilintide alone, and placebo groups, with lifestyle intervention across groups.

Under the treatment-policy estimand, mean body-weight change was minus 20.4% with CagriSema and minus 3.0% with placebo. The study also included 302 participants assigned to cagrilintide alone, which adds longer phase 3 component data to the earlier monotherapy program.

The primary confirmatory comparisons focused on CagriSema versus placebo. Component-arm observations are informative, but they should be interpreted according to the prespecified statistical plan rather than converted into unlimited head-to-head claims. Gastrointestinal adverse events were common in the combination group.

REDEFINE 2: combination evidence in type 2 diabetes

REDEFINE 2 separately enrolled 1,206 adults with type 2 diabetes and overweight or obesity. Participants were randomized to CagriSema or placebo for 68 weeks alongside lifestyle intervention. The trial assessed body weight, glycated hemoglobin, and safety in a population distinct from REDEFINE 1.

The published study reported greater mean body-weight reduction and improvement in glycated hemoglobin with CagriSema than placebo. Those findings apply to the tested combination and enrolled diabetes population.

They do not establish the effect of cagrilintide alone, and results should not be pooled casually with a trial in people without diabetes. Baseline disease, concurrent medicines, outcomes, and adverse-event context differ.

Cagrilintide is not CagriSema

Cagrilintide is one modified amylin analogue. CagriSema is an investigational fixed-dose combination containing cagrilintide and semaglutide. The names are related, but the test articles and evidence questions are not interchangeable.

A combination trial can show what happened when both components were given in one defined program. It cannot reveal automatically how much of each outcome came from cagrilintide, semaglutide, an additive effect, an interaction, treatment persistence, or another part of the protocol.

This distinction also applies to supplier blends. A catalog blend is not CagriSema merely because it names the same two molecules. Formulation, ratio, manufacturing, impurity controls, stability, presentation, and clinical evidence are product-specific.

FDA status as of October 22, 2026

Cagrilintide is not an FDA-approved drug. FDA's current page on unapproved products used for weight loss states that cagrilintide and retatrutide are not components of FDA-approved drugs, have not been found safe and effective for any condition, and cannot be used in compounding under federal law.

The FDA substance record for cagrilintide identifies the molecule and assigns a UNII, but the record explicitly warns that UNII availability does not imply regulatory review or approval. Substance registration and drug-product approval are different systems.

Novo Nordisk states that it submitted a New Drug Application for CagriSema in December 2025 and that CagriSema remains unapproved in the United States and European Union. A pending application is not an approval, and its existence does not authorize cagrilintide monotherapy or research-market products.

Safety evidence has product and trial boundaries

Across the published clinical program, gastrointestinal events such as nausea, constipation, diarrhea, vomiting, and abdominal discomfort were prominent. Their frequency varied with the trial, group, population, duration, and estimand. A fair summary reports adverse events and discontinuations alongside average efficacy results.

The available trials do not settle every long-term question, uncommon event, interaction, or outcome in populations that were excluded or sparsely represented. The combination program also cannot define the complete safety profile of cagrilintide alone.

Clinical safety data concern sponsor-manufactured investigational material used under controlled protocols. They do not characterize risks caused by mislabeling, incorrect quantity, contamination, aggregation, degradation, microbial burden, or endotoxin in an unrelated vial.

Scientific evidence and supplier evidence answer different questions

Scientific publications ask what a defined test article did in a specified experiment or trial. Supplier documentation asks whether a current sample or lot has the identity, purity, quantity, and other quality attributes represented. Evidence in one category cannot substitute for the other.

A phase 3 publication cannot authenticate a commercial vial. Conversely, a coherent mass spectrum and chromatogram can support analytical claims about one sample but cannot prove weight-management efficacy, human safety, lawful compounding, or equivalence to investigational CagriSema.

The phrase research use only is an intended-use restriction, not a quality measurement or regulatory approval. Due diligence should preserve separate literature, regulatory, and lot-level documentation records.

Analytical questions for cagrilintide research material

Cagrilintide presents more identity questions than a short, unmodified linear peptide. Documentation should specify the complete 37-residue backbone, the second-to-seventh-residue disulfide, C-terminal proline amide, N-terminal lysine modification, gamma-glutamyl linker, C20 fatty diacid, and stated salt form.

Mass spectrometry can support molecular identity when expected and observed species are coherently reported. A headline HPLC area percentage does not establish correct disulfide connectivity, attachment site, absolute peptide content, absence of closely related conjugation or sequence impurities, aggregation state, sterility, endotoxin, or stability.

Because the molecule was designed partly to reduce fibrillation and improve physical stability, appearance and a purity number are especially weak substitutes for stability-indicating evidence. Lot matching, sample identity, chromatographic conditions, quantitative content, water, counterion or salt, residual solvents, aggregation, and degradation each require appropriate records or methods.

• Complete backbone sequence and C-terminal amidation
• Disulfide connectivity between the stated cysteine residues
• N-terminal linker, C20 fatty-diacid identity, and attachment site
• Salt or counterion form and the basis of the labeled quantity
• Lot-matched identity, chromatographic purity, and quantitative content reported separately
• Method-appropriate evidence for aggregation, degradation, water, residual solvents, sterility, or endotoxin claims
• No claim of equivalence to sponsor trial material or CagriSema without a product-level evidence package

Limitations and unresolved questions

The receptor work continues to refine how cagrilintide engages AMY1, AMY2, AMY3, and calcitonin receptors, but the relative contribution of each receptor population to human outcomes remains unresolved. Mechanistic plausibility should not be presented as a complete causal explanation.

Most pivotal development was sponsored by Novo Nordisk, and many authors were employees or investigators with industry relationships. Sponsorship does not erase randomization, prespecified outcomes, peer review, or regulatory scrutiny, but it is relevant context and makes independent replication valuable.

Longer monotherapy follow-up, direct active-comparator trials, cardiovascular-outcomes data, broader population evidence, and postmarket surveillance would answer questions the current program cannot. Regulatory conclusions also require a current date because a pending application can later be approved, delayed, changed, or declined.

FAQ: Is cagrilintide a GLP-1 receptor agonist?

No. Cagrilintide is a long-acting amylin analogue that acts within the calcitonin and amylin receptor family. It has been studied with the GLP-1 receptor agonist semaglutide, but combination research does not turn cagrilintide itself into a GLP-1 agonist.

FAQ: Is CagriSema the same as cagrilintide?

No. Cagrilintide is one component. CagriSema is the investigational combination of cagrilintide and semaglutide. Evidence for the combination cannot be attributed automatically to cagrilintide alone, and a supplier blend does not become CagriSema by using both ingredient names.

FAQ: Does an FDA UNII mean cagrilintide is approved?

No. A UNII is a substance identifier. FDA's substance-search page states directly that UNII availability does not imply regulatory review or approval. As of October 22, 2026, FDA states that cagrilintide is not a component of an approved drug and has not been found safe and effective for any condition.

FAQ: Does 99% HPLC purity prove equivalence to clinical-trial material?

No. An HPLC area percentage describes detector response under one chromatographic method. It does not prove complete molecular identity, correct lipid attachment and disulfide connectivity, net peptide content, aggregation state, sterility, stability, formulation, manufacturing controls, or clinical equivalence.

The defensible conclusion

Cagrilintide has a defined modified-peptide identity and a growing evidence base extending from receptor and animal studies to randomized monotherapy and combination trials. The phase 2 monotherapy trial supports a body-weight signal in its enrolled population, while phase 3 CagriSema trials support conclusions about the tested combination.

The molecule remains investigational and is not FDA approved. None of the clinical evidence authenticates a research-market vial. Reliable due diligence keeps four layers separate: exact chemical identity, preclinical biology, human monotherapy and combination evidence, and lot-specific supplier documentation.